PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003801P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 189aa    MW: 21113.5 Da    PI: 10.3168
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003801P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.81.4e-231461249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    + e ks +qvtfskRr+g++KKA ELSvLC+aeva+i+fs+++k++ +
  MELO3C003801P1 14 KLEKKSSKQVTFSKRRAGLFKKAGELSVLCGAEVAIIVFSPNDKVFCF 61
                    67899***************************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.039565IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-33564IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-28675IPR002100Transcription factor, MADS-box
PROSITE patternPS003500761IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-21727IPR002100Transcription factor, MADS-box
PfamPF003196.1E-241561IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-212742IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-214263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MKKTLGRQKI EIKKLEKKSS KQVTFSKRRA GLFKKAGELS VLCGAEVAII VFSPNDKVFC  60
FGHPDVDVLL DRYLTGNLSP PKPAESYIPV AEFNRDFADF ALEFEAEKKR AAELIRAAED  120
SRKNGGFWWQ EAAEGMRLEE LKDFRSALMD LRAKVAERVE KLTAVRIGGP LLPALPPPPQ  180
PLSRSRSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-17686177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-17686177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-17686177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-17686177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-17686177Myocyte-specific enhancer factor 2A
3kov_B2e-17686177Myocyte-specific enhancer factor 2A
3kov_I2e-17686177Myocyte-specific enhancer factor 2A
3kov_J2e-17686177Myocyte-specific enhancer factor 2A
3p57_A2e-17686177Myocyte-specific enhancer factor 2A
3p57_B2e-17686177Myocyte-specific enhancer factor 2A
3p57_C2e-17686177Myocyte-specific enhancer factor 2A
3p57_D2e-17686177Myocyte-specific enhancer factor 2A
3p57_I2e-17686177Myocyte-specific enhancer factor 2A
3p57_J2e-17686177Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466532.11e-129PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0A0LE011e-108A0A0A0LE01_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-34AGAMOUS-like 62